General Information

  • ID:  hor005640
  • Uniprot ID:  Q27441
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  NPY
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Highly expressed in the abdominal ganglion, to lesser extent in the pleural-pedal ganglion and much lower in the cerebral ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GKRGDSFRKREFFRTNGERYPEDAAAWTEFQ
  • Length:  31(62-92)
  • Propeptide:  MQRVILVVLLLSCMAVLSVRADNSEMLAPPPRPEEFTSAQQLRQYLAALNEYYSIMGRPRFGKRGDSFRKREFFRTNGERYPEDAAAWTEFQ
  • Signal peptide:  MQRVILVVLLLSCMAVLSVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play a role in the regulation of viscermotor functions during egg laying.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q27441-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005640_AF2.pdbhor005640_ESM.pdb

Physical Information

Mass: 428832 Formula: C166H243N51O50
Absent amino acids: CHILMV Common amino acids: R
pI: 9.25 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: -157.74 Boman Index: -12874
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 9.68
Instability Index: 3404.84 Extinction Coefficient cystines: 6990
Absorbance 280nm: 233

Literature

  • PubMed ID:  NA
  • Title:  NA